Icon representing a puzzle

2462: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since almost 2 years ago

Novice Overall Prediction

Summary


Created
May 21, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups


  1. Avatar for Go Science 100 pts. 10,657
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 56 pts. 10,610
  3. Avatar for Marvin's bunch 3. Marvin's bunch 29 pts. 10,543
  4. Avatar for Contenders 4. Contenders 14 pts. 10,407
  5. Avatar for Void Crushers 5. Void Crushers 6 pts. 10,271
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 2 pts. 10,169
  7. Avatar for Australia 7. Australia 1 pt. 10,158
  8. Avatar for VeFold 8. VeFold 1 pt. 10,095
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 10,033
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 9,011

  1. Avatar for heather-1 31. heather-1 Lv 1 8 pts. 9,762
  2. Avatar for pfirth 32. pfirth Lv 1 7 pts. 9,695
  3. Avatar for NPrincipi 33. NPrincipi Lv 1 6 pts. 9,689
  4. Avatar for alcor29 34. alcor29 Lv 1 5 pts. 9,623
  5. Avatar for ProfVince 35. ProfVince Lv 1 5 pts. 9,541
  6. Avatar for Merf 36. Merf Lv 1 4 pts. 9,540
  7. Avatar for maithra 37. maithra Lv 1 4 pts. 9,448
  8. Avatar for roarshock 38. roarshock Lv 1 3 pts. 9,422
  9. Avatar for Simek 39. Simek Lv 1 3 pts. 9,415
  10. Avatar for Dr.Sillem 40. Dr.Sillem Lv 1 3 pts. 9,413

Comments