Icon representing a puzzle

2462: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since almost 2 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 21, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups


  1. Avatar for Go Science 100 pts. 10,657
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 56 pts. 10,610
  3. Avatar for Marvin's bunch 3. Marvin's bunch 29 pts. 10,543
  4. Avatar for Contenders 4. Contenders 14 pts. 10,407
  5. Avatar for Void Crushers 5. Void Crushers 6 pts. 10,271
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 2 pts. 10,169
  7. Avatar for Australia 7. Australia 1 pt. 10,158
  8. Avatar for VeFold 8. VeFold 1 pt. 10,095
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 10,033
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 9,011

  1. Avatar for Arne Heessels 61. Arne Heessels Lv 1 1 pt. 8,597
  2. Avatar for evifnoskcaj 62. evifnoskcaj Lv 1 1 pt. 8,550
  3. Avatar for mengzach 63. mengzach Lv 1 1 pt. 8,367
  4. Avatar for latin krepin 64. latin krepin Lv 1 1 pt. 8,325
  5. Avatar for apetrides 65. apetrides Lv 1 1 pt. 8,229
  6. Avatar for I-AM-A-NOOB 66. I-AM-A-NOOB Lv 1 1 pt. 8,017
  7. Avatar for furi0us 67. furi0us Lv 1 1 pt. 7,888
  8. Avatar for LXY 68. LXY Lv 1 1 pt. 7,863
  9. Avatar for Kimdonghyeon 69. Kimdonghyeon Lv 1 1 pt. 7,849
  10. Avatar for Swapper242 70. Swapper242 Lv 1 1 pt. 7,694

Comments