Icon representing a puzzle

2468: Revisiting Puzzle 59: TCR Binding Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
May 21, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 9,497
  2. Avatar for Kotocycle 12. Kotocycle 1 pt. 9,333
  3. Avatar for Team China 13. Team China 1 pt. 9,267
  4. Avatar for Beta Folders 14. Beta Folders 1 pt. 8,899
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,735
  6. Avatar for Window Group 16. Window Group 1 pt. 6,495
  7. Avatar for Rechenkraft.net 17. Rechenkraft.net 1 pt. 2,942
  1. Avatar for BootsMcGraw 21. BootsMcGraw Lv 1 22 pts. 9,943
  2. Avatar for BarrySampson 22. BarrySampson Lv 1 20 pts. 9,936
  3. Avatar for gmn 23. gmn Lv 1 19 pts. 9,931
  4. Avatar for SemperRabbit 24. SemperRabbit Lv 1 17 pts. 9,925
  5. Avatar for akaaka 25. akaaka Lv 1 15 pts. 9,891
  6. Avatar for AlkiP0Ps 26. AlkiP0Ps Lv 1 14 pts. 9,853
  7. Avatar for AlphaFold2 27. AlphaFold2 Lv 1 13 pts. 9,844
  8. Avatar for Bletchley Park 28. Bletchley Park Lv 1 12 pts. 9,808
  9. Avatar for ShadowTactics 29. ShadowTactics Lv 1 11 pts. 9,780
  10. Avatar for Idiotboy 30. Idiotboy Lv 1 10 pts. 9,768

Comments