Icon representing a puzzle

2468: Revisiting Puzzle 59: TCR Binding Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
May 21, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,205
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 10,110
  3. Avatar for Marvin's bunch 3. Marvin's bunch 52 pts. 10,071
  4. Avatar for Contenders 4. Contenders 36 pts. 10,048
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 24 pts. 9,994
  6. Avatar for VeFold 6. VeFold 16 pts. 9,936
  7. Avatar for Australia 7. Australia 10 pts. 9,853
  8. Avatar for BOINC@Poland 8. BOINC@Poland 6 pts. 9,780
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 4 pts. 9,710
  10. Avatar for Russian team 10. Russian team 2 pts. 9,506
  1. Avatar for BootsMcGraw 21. BootsMcGraw Lv 1 22 pts. 9,943
  2. Avatar for BarrySampson 22. BarrySampson Lv 1 20 pts. 9,936
  3. Avatar for gmn 23. gmn Lv 1 19 pts. 9,931
  4. Avatar for SemperRabbit 24. SemperRabbit Lv 1 17 pts. 9,925
  5. Avatar for akaaka 25. akaaka Lv 1 15 pts. 9,891
  6. Avatar for AlkiP0Ps 26. AlkiP0Ps Lv 1 14 pts. 9,853
  7. Avatar for AlphaFold2 27. AlphaFold2 Lv 1 13 pts. 9,844
  8. Avatar for Bletchley Park 28. Bletchley Park Lv 1 12 pts. 9,808
  9. Avatar for ShadowTactics 29. ShadowTactics Lv 1 11 pts. 9,780
  10. Avatar for Idiotboy 30. Idiotboy Lv 1 10 pts. 9,768

Comments