Icon representing a puzzle

2468: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
May 21, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 9,497
  2. Avatar for Kotocycle 12. Kotocycle 1 pt. 9,333
  3. Avatar for Team China 13. Team China 1 pt. 9,267
  4. Avatar for Beta Folders 14. Beta Folders 1 pt. 8,899
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,735
  6. Avatar for Window Group 16. Window Group 1 pt. 6,495
  7. Avatar for Rechenkraft.net 17. Rechenkraft.net 1 pt. 2,942
  1. Avatar for Antibrad 61. Antibrad Lv 1 1 pt. 8,899
  2. Avatar for hookedwarm 62. hookedwarm Lv 1 1 pt. 8,889
  3. Avatar for Trajan464 63. Trajan464 Lv 1 1 pt. 8,887
  4. Avatar for DrAeroplane 64. DrAeroplane Lv 1 1 pt. 8,887
  5. Avatar for Swapper242 65. Swapper242 Lv 1 1 pt. 8,825
  6. Avatar for Rocky Roccoco 66. Rocky Roccoco Lv 1 1 pt. 8,824
  7. Avatar for dahast.de 67. dahast.de Lv 1 1 pt. 8,735
  8. Avatar for Eugen 68. Eugen Lv 1 1 pt. 8,673
  9. Avatar for konikula 69. konikula Lv 1 1 pt. 8,604
  10. Avatar for messier81 70. messier81 Lv 1 1 pt. 8,603

Comments