Icon representing a puzzle

2468: Revisiting Puzzle 59: TCR Binding Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
May 21, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,205
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 10,110
  3. Avatar for Marvin's bunch 3. Marvin's bunch 52 pts. 10,071
  4. Avatar for Contenders 4. Contenders 36 pts. 10,048
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 24 pts. 9,994
  6. Avatar for VeFold 6. VeFold 16 pts. 9,936
  7. Avatar for Australia 7. Australia 10 pts. 9,853
  8. Avatar for BOINC@Poland 8. BOINC@Poland 6 pts. 9,780
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 4 pts. 9,710
  10. Avatar for Russian team 10. Russian team 2 pts. 9,506
  1. Avatar for Antibrad 61. Antibrad Lv 1 1 pt. 8,899
  2. Avatar for hookedwarm 62. hookedwarm Lv 1 1 pt. 8,889
  3. Avatar for Trajan464 63. Trajan464 Lv 1 1 pt. 8,887
  4. Avatar for DrAeroplane 64. DrAeroplane Lv 1 1 pt. 8,887
  5. Avatar for Swapper242 65. Swapper242 Lv 1 1 pt. 8,825
  6. Avatar for Rocky Roccoco 66. Rocky Roccoco Lv 1 1 pt. 8,824
  7. Avatar for dahast.de 67. dahast.de Lv 1 1 pt. 8,735
  8. Avatar for Eugen 68. Eugen Lv 1 1 pt. 8,673
  9. Avatar for konikula 69. konikula Lv 1 1 pt. 8,604
  10. Avatar for messier81 70. messier81 Lv 1 1 pt. 8,603

Comments