Placeholder image of a protein
Icon representing a puzzle

2463: Electron Density Reconstruction 91

Closed since almost 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
May 29, 2024
Expires
Max points
100
Description

We're going to take a break for a week from puzzles with the Refine Density tool and do an old-fashioned Reconstruction puzzle. The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. Previously, we had a puzzle in which there was a Hoogsteen base pair in this structure, but now it has a Watson-Crick base pair instead. Also, a useful note from Bletchley Park for working with DNA: DNA sidechains can be turned relative to their blue arms with bands.

Sequence
MGNLSYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGGKSGKAPRRRAVS. CTATGTAAACAAC. GTTGTTTACATAG

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 36,624
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 56 pts. 36,616
  3. Avatar for Go Science 3. Go Science 29 pts. 36,526
  4. Avatar for Contenders 4. Contenders 14 pts. 36,163
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 6 pts. 36,052
  6. Avatar for Marvin's bunch 6. Marvin's bunch 2 pts. 35,993
  7. Avatar for Australia 7. Australia 1 pt. 35,475
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 35,404
  9. Avatar for VeFold 9. VeFold 1 pt. 34,769
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 33,816
  1. Avatar for hada 41. hada Lv 1 1 pt. 33,276
  2. Avatar for Larini 42. Larini Lv 1 1 pt. 33,072
  3. Avatar for Vinara 43. Vinara Lv 1 1 pt. 32,981
  4. Avatar for pfirth 44. pfirth Lv 1 1 pt. 32,793
  5. Avatar for Mohoernchen 45. Mohoernchen Lv 1 1 pt. 32,054
  6. Avatar for Dr.Sillem 46. Dr.Sillem Lv 1 1 pt. 32,031
  7. Avatar for rinze 47. rinze Lv 1 1 pt. 31,881
  8. Avatar for DScott 48. DScott Lv 1 1 pt. 31,778
  9. Avatar for Th1sN@me!sN0tAPun 49. Th1sN@me!sN0tAPun Lv 1 1 pt. 31,691
  10. Avatar for evifnoskcaj 50. evifnoskcaj Lv 1 1 pt. 31,675

Comments