2463: Electron Density Reconstruction 91
Closed since almost 2 years ago
Novice Overall Prediction Electron DensitySummary
- Created
- May 29, 2024
- Expires
- Max points
- 100
We're going to take a break for a week from puzzles with the Refine Density tool and do an old-fashioned Reconstruction puzzle. The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. Previously, we had a puzzle in which there was a Hoogsteen base pair in this structure, but now it has a Watson-Crick base pair instead. Also, a useful note from Bletchley Park for working with DNA: DNA sidechains can be turned relative to their blue arms with bands.
- Sequence
- MGNLSYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGGKSGKAPRRRAVS. CTATGTAAACAAC. GTTGTTTACATAG
