Placeholder image of a protein
Icon representing a puzzle

2469: Electron Density Reconstruction 93

Closed since almost 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
June 07, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's got two chains that are the same. Of note, this protein may look familiar, as it's a protein commonly used by crystallographers to test methods, and so it's been solved many times, but some of these could use re-examination. For this first round of this puzzle, we won't have the Refine Density tool active.

Sequence
MNLFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPDLNVAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRNPKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTDSLRMLQQKRWDEAAANLAKSRWYNQTPDRAKRVITTFRTGTWDAYKNL

Top groups


  1. Avatar for Russian team 11. Russian team 1 pt. 28,931
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 28,908
  3. Avatar for Window Group 13. Window Group 1 pt. 22,664
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 22,499

  1. Avatar for hada 31. hada Lv 1 3 pts. 28,999
  2. Avatar for Ikuso 32. Ikuso Lv 1 2 pts. 28,995
  3. Avatar for Larini 33. Larini Lv 1 2 pts. 28,944
  4. Avatar for Gerom 34. Gerom Lv 1 2 pts. 28,931
  5. Avatar for zbp 35. zbp Lv 1 1 pt. 28,924
  6. Avatar for ShadowTactics 36. ShadowTactics Lv 1 1 pt. 28,908
  7. Avatar for maithra 37. maithra Lv 1 1 pt. 28,830
  8. Avatar for goldfish80 38. goldfish80 Lv 1 1 pt. 28,694
  9. Avatar for abiogenesis 39. abiogenesis Lv 1 1 pt. 28,653
  10. Avatar for pfirth 40. pfirth Lv 1 1 pt. 28,635

Comments