2469: Electron Density Reconstruction 93
Closed since over 1 year ago
Novice Overall Prediction Electron DensitySummary
- Created
- June 07, 2024
- Expires
- Max points
- 100
The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's got two chains that are the same. Of note, this protein may look familiar, as it's a protein commonly used by crystallographers to test methods, and so it's been solved many times, but some of these could use re-examination. For this first round of this puzzle, we won't have the Refine Density tool active.
- Sequence
- MNLFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPDLNVAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRNPKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTDSLRMLQQKRWDEAAANLAKSRWYNQTPDRAKRVITTFRTGTWDAYKNL
Top groups
-
100 pts. 29,320
-
-
-
-
-
-
-
-
-
