Placeholder image of a protein
Icon representing a puzzle

2469: Electron Density Reconstruction 93

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
June 07, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's got two chains that are the same. Of note, this protein may look familiar, as it's a protein commonly used by crystallographers to test methods, and so it's been solved many times, but some of these could use re-examination. For this first round of this puzzle, we won't have the Refine Density tool active.

Sequence
MNLFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPDLNVAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRNPKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTDSLRMLQQKRWDEAAANLAKSRWYNQTPDRAKRVITTFRTGTWDAYKNL

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 29,320
  2. Avatar for Go Science 2. Go Science 68 pts. 29,293
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 29,289
  4. Avatar for Contenders 4. Contenders 27 pts. 29,278
  5. Avatar for Australia 5. Australia 16 pts. 29,182
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 29,165
  7. Avatar for Void Crushers 7. Void Crushers 5 pts. 29,128
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 3 pts. 29,085
  9. Avatar for VeFold 9. VeFold 1 pt. 29,044
  10. Avatar for Kotocycle 10. Kotocycle 1 pt. 28,995
  1. Avatar for rinze 51. rinze Lv 1 1 pt. 28,307
  2. Avatar for Swapper242 52. Swapper242 Lv 1 1 pt. 28,240
  3. Avatar for dasongle 53. dasongle Lv 1 1 pt. 27,344
  4. Avatar for furi0us 54. furi0us Lv 1 1 pt. 27,344
  5. Avatar for jflat06 55. jflat06 Lv 1 1 pt. 22,664
  6. Avatar for Serca 56. Serca Lv 1 1 pt. 22,499
  7. Avatar for rmoretti 57. rmoretti Lv 1 1 pt. 22,499

Comments