Placeholder image of a protein
Icon representing a puzzle

2472: Electron Density Reconstruction 94

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
June 13, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's got two chains that are the same. For this first round of this puzzle, we won't have the Refine Density tool active. There's two identical chains here, but different parts may be not visible in each.

Sequence
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWE

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 17,586
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 17,024
  3. Avatar for Firesign 13. Firesign 1 pt. 16,981
  4. Avatar for Window Group 14. Window Group 1 pt. 14,483
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 17,916
  2. Avatar for Galaxie 2. Galaxie Lv 1 92 pts. 17,898
  3. Avatar for grogar7 3. grogar7 Lv 1 84 pts. 17,895
  4. Avatar for Bletchley Park 4. Bletchley Park Lv 1 77 pts. 17,895
  5. Avatar for christioanchauvin 5. christioanchauvin Lv 1 70 pts. 17,888
  6. Avatar for MicElephant 6. MicElephant Lv 1 64 pts. 17,887
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 58 pts. 17,886
  8. Avatar for Sandrix72 8. Sandrix72 Lv 1 53 pts. 17,885
  9. Avatar for gmn 9. gmn Lv 1 48 pts. 17,881
  10. Avatar for dcrwheeler 10. dcrwheeler Lv 1 44 pts. 17,877

Comments