2472: Electron Density Reconstruction 94

Closed since over 1 year ago

Summary

• Created: June 13, 2024
• Expires: June 27, 2024 at 18:00 UTC
• Max points: 100

Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's got two chains that are the same. For this first round of this puzzle, we won't have the Refine Density tool active. There's two identical chains here, but different parts may be not visible in each.

• Sequence: NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWE

Top groups

• 1. Anthropic Dreams 100 pts. 17,918
• 2. Contenders 68 pts. 17,895
• 3. L'Alliance Francophone 44 pts. 17,888
• 4. Go Science 27 pts. 17,886
• 5. Marvin's bunch 16 pts. 17,874
• 6. Australia 9 pts. 17,829
• 7. Void Crushers 5 pts. 17,794
• 8. FamilyBarmettler 3 pts. 17,682
• 9. Kotocycle 1 pt. 17,670
• 10. VeFold 1 pt. 17,648

Top soloists

• 1. LociOiling 100 pts. 17,916
• 2. Galaxie 92 pts. 17,898
• 3. grogar7 84 pts. 17,895
• 4. Bletchley Park 77 pts. 17,895
• 5. christioanchauvin 70 pts. 17,888
• 6. MicElephant 64 pts. 17,887
• 7. Bruno Kestemont 58 pts. 17,886
• 8. Sandrix72 53 pts. 17,885
• 9. gmn 48 pts. 17,881
• 10. dcrwheeler 44 pts. 17,877