Placeholder image of a protein
Icon representing a puzzle

2472: Electron Density Reconstruction 94

Closed since almost 2 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
June 13, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's got two chains that are the same. For this first round of this puzzle, we won't have the Refine Density tool active. There's two identical chains here, but different parts may be not visible in each.

Sequence
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 17,918
  2. Avatar for Contenders 2. Contenders 68 pts. 17,895
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 17,888
  4. Avatar for Go Science 4. Go Science 27 pts. 17,886
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 17,874
  6. Avatar for Australia 6. Australia 9 pts. 17,829
  7. Avatar for Void Crushers 7. Void Crushers 5 pts. 17,794
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 3 pts. 17,682
  9. Avatar for Kotocycle 9. Kotocycle 1 pt. 17,670
  10. Avatar for VeFold 10. VeFold 1 pt. 17,648

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 17,916
  2. Avatar for Galaxie 2. Galaxie Lv 1 92 pts. 17,898
  3. Avatar for grogar7 3. grogar7 Lv 1 84 pts. 17,895
  4. Avatar for Bletchley Park 4. Bletchley Park Lv 1 77 pts. 17,895
  5. Avatar for christioanchauvin 5. christioanchauvin Lv 1 70 pts. 17,888
  6. Avatar for MicElephant 6. MicElephant Lv 1 64 pts. 17,887
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 58 pts. 17,886
  8. Avatar for Sandrix72 8. Sandrix72 Lv 1 53 pts. 17,885
  9. Avatar for gmn 9. gmn Lv 1 48 pts. 17,881
  10. Avatar for dcrwheeler 10. dcrwheeler Lv 1 44 pts. 17,877

Comments