Icon representing a puzzle

2471: Revisiting Puzzle 60: Beta Barrel

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
June 19, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 11,498
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 10,862
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 4,514
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 12,872
  2. Avatar for Serca 2. Serca Lv 1 94 pts. 12,741
  3. Avatar for Punzi Baker 3 3. Punzi Baker 3 Lv 1 87 pts. 12,705
  4. Avatar for Sandrix72 4. Sandrix72 Lv 1 81 pts. 12,699
  5. Avatar for blazegeek 5. blazegeek Lv 1 75 pts. 12,697
  6. Avatar for MicElephant 6. MicElephant Lv 1 70 pts. 12,679
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 64 pts. 12,678
  8. Avatar for orily1337 8. orily1337 Lv 1 60 pts. 12,612
  9. Avatar for grogar7 9. grogar7 Lv 1 55 pts. 12,609
  10. Avatar for dcrwheeler 10. dcrwheeler Lv 1 51 pts. 12,576

Comments