Icon representing a puzzle

2471: Revisiting Puzzle 60: Beta Barrel

Closed since almost 2 years ago

Novice Overall Prediction

Summary


Created
June 19, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,872
  2. Avatar for Go Science 2. Go Science 65 pts. 12,741
  3. Avatar for Contenders 3. Contenders 41 pts. 12,679
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 12,612
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 14 pts. 12,495
  6. Avatar for Void Crushers 6. Void Crushers 7 pts. 12,176
  7. Avatar for Australia 7. Australia 4 pts. 12,148
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 2 pts. 12,058
  9. Avatar for VeFold 9. VeFold 1 pt. 11,756
  10. Avatar for Team China 10. Team China 1 pt. 11,506

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 12,872
  2. Avatar for Serca 2. Serca Lv 1 94 pts. 12,741
  3. Avatar for Punzi Baker 3 3. Punzi Baker 3 Lv 1 87 pts. 12,705
  4. Avatar for Sandrix72 4. Sandrix72 Lv 1 81 pts. 12,699
  5. Avatar for blazegeek 5. blazegeek Lv 1 75 pts. 12,697
  6. Avatar for MicElephant 6. MicElephant Lv 1 70 pts. 12,679
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 64 pts. 12,678
  8. Avatar for orily1337 8. orily1337 Lv 1 60 pts. 12,612
  9. Avatar for grogar7 9. grogar7 Lv 1 55 pts. 12,609
  10. Avatar for dcrwheeler 10. dcrwheeler Lv 1 51 pts. 12,576

Comments