Icon representing a puzzle

2471: Revisiting Puzzle 60: Beta Barrel

Closed since almost 2 years ago

Novice Overall Prediction

Summary


Created
June 19, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,872
  2. Avatar for Go Science 2. Go Science 65 pts. 12,741
  3. Avatar for Contenders 3. Contenders 41 pts. 12,679
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 12,612
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 14 pts. 12,495
  6. Avatar for Void Crushers 6. Void Crushers 7 pts. 12,176
  7. Avatar for Australia 7. Australia 4 pts. 12,148
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 2 pts. 12,058
  9. Avatar for VeFold 9. VeFold 1 pt. 11,756
  10. Avatar for Team China 10. Team China 1 pt. 11,506

  1. Avatar for maithra 31. maithra Lv 1 7 pts. 11,862
  2. Avatar for Th1sN@me!sN0tAPun 32. Th1sN@me!sN0tAPun Lv 1 6 pts. 11,846
  3. Avatar for AlphaFold2 33. AlphaFold2 Lv 1 5 pts. 11,756
  4. Avatar for nicobul 34. nicobul Lv 1 5 pts. 11,749
  5. Avatar for akaaka 35. akaaka Lv 1 4 pts. 11,703
  6. Avatar for BarrySampson 36. BarrySampson Lv 1 4 pts. 11,651
  7. Avatar for mengzach 37. mengzach Lv 1 3 pts. 11,607
  8. Avatar for vybi 38. vybi Lv 1 3 pts. 11,568
  9. Avatar for Trajan464 39. Trajan464 Lv 1 2 pts. 11,551
  10. Avatar for heather-1 40. heather-1 Lv 1 2 pts. 11,525

Comments