Icon representing a puzzle

2471: Revisiting Puzzle 60: Beta Barrel

Closed since almost 2 years ago

Novice Overall Prediction

Summary


Created
June 19, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,872
  2. Avatar for Go Science 2. Go Science 65 pts. 12,741
  3. Avatar for Contenders 3. Contenders 41 pts. 12,679
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 12,612
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 14 pts. 12,495
  6. Avatar for Void Crushers 6. Void Crushers 7 pts. 12,176
  7. Avatar for Australia 7. Australia 4 pts. 12,148
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 2 pts. 12,058
  9. Avatar for VeFold 9. VeFold 1 pt. 11,756
  10. Avatar for Team China 10. Team China 1 pt. 11,506

  1. Avatar for messier81 41. messier81 Lv 1 2 pts. 11,506
  2. Avatar for ShadowTactics 42. ShadowTactics Lv 1 2 pts. 11,498
  3. Avatar for Dr.Sillem 43. Dr.Sillem Lv 1 2 pts. 11,490
  4. Avatar for Arne Heessels 44. Arne Heessels Lv 1 1 pt. 11,436
  5. Avatar for Alistair69 45. Alistair69 Lv 1 1 pt. 11,377
  6. Avatar for DScott 46. DScott Lv 1 1 pt. 11,354
  7. Avatar for Merf 47. Merf Lv 1 1 pt. 11,322
  8. Avatar for haleyg 48. haleyg Lv 1 1 pt. 11,319
  9. Avatar for Mohoernchen 49. Mohoernchen Lv 1 1 pt. 11,279
  10. Avatar for zbp 50. zbp Lv 1 1 pt. 11,256

Comments