Icon representing a puzzle

2471: Revisiting Puzzle 60: Beta Barrel

Closed since almost 2 years ago

Novice Overall Prediction

Summary


Created
June 19, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,872
  2. Avatar for Go Science 2. Go Science 65 pts. 12,741
  3. Avatar for Contenders 3. Contenders 41 pts. 12,679
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 12,612
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 14 pts. 12,495
  6. Avatar for Void Crushers 6. Void Crushers 7 pts. 12,176
  7. Avatar for Australia 7. Australia 4 pts. 12,148
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 2 pts. 12,058
  9. Avatar for VeFold 9. VeFold 1 pt. 11,756
  10. Avatar for Team China 10. Team China 1 pt. 11,506

  1. Avatar for carxo 51. carxo Lv 1 1 pt. 11,244
  2. Avatar for rinze 52. rinze Lv 1 1 pt. 11,186
  3. Avatar for abiogenesis 53. abiogenesis Lv 1 1 pt. 11,171
  4. Avatar for hada 54. hada Lv 1 1 pt. 11,103
  5. Avatar for Rav3n_pl 55. Rav3n_pl Lv 1 1 pt. 11,102
  6. Avatar for Simek 56. Simek Lv 1 1 pt. 11,047
  7. Avatar for evifnoskcaj 57. evifnoskcaj Lv 1 1 pt. 10,998
  8. Avatar for pfirth 58. pfirth Lv 1 1 pt. 10,985
  9. Avatar for Kimdonghyeon 59. Kimdonghyeon Lv 1 1 pt. 10,915
  10. Avatar for Sammy3c2b1a0 60. Sammy3c2b1a0 Lv 1 1 pt. 10,862

Comments