Icon representing a puzzle

2471: Revisiting Puzzle 60: Beta Barrel

Closed since almost 2 years ago

Novice Overall Prediction

Summary


Created
June 19, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,872
  2. Avatar for Go Science 2. Go Science 65 pts. 12,741
  3. Avatar for Contenders 3. Contenders 41 pts. 12,679
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 12,612
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 14 pts. 12,495
  6. Avatar for Void Crushers 6. Void Crushers 7 pts. 12,176
  7. Avatar for Australia 7. Australia 4 pts. 12,148
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 2 pts. 12,058
  9. Avatar for VeFold 9. VeFold 1 pt. 11,756
  10. Avatar for Team China 10. Team China 1 pt. 11,506

  1. Avatar for mart0258 61. mart0258 Lv 1 1 pt. 10,822
  2. Avatar for osc 62. osc Lv 1 1 pt. 10,811
  3. Avatar for DipsyDoodle2016 63. DipsyDoodle2016 Lv 1 1 pt. 10,800
  4. Avatar for bazoo27 64. bazoo27 Lv 1 1 pt. 10,755
  5. Avatar for Swapper242 65. Swapper242 Lv 1 1 pt. 10,735
  6. Avatar for furi0us 66. furi0us Lv 1 1 pt. 10,633
  7. Avatar for cflep219 67. cflep219 Lv 1 1 pt. 10,627
  8. Avatar for ipatrol 68. ipatrol Lv 1 1 pt. 10,427
  9. Avatar for SunnyStreaming 69. SunnyStreaming Lv 1 1 pt. 4,514
  10. Avatar for spvincent 70. spvincent Lv 1 1 pt. 4,514

Comments