Placeholder image of a protein
Icon representing a puzzle

2475: Electron Density Reconstruction 95

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
June 21, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's got two chains that are the same. For this first round of this puzzle, we won't have the Refine Density tool active. There's two identical chains here, but different parts may be not visible in each.

Sequence
MKHHHHHHPMSGLVPRGSMALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 37,833
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 36,715
  3. Avatar for Window Group 13. Window Group 1 pt. 15,640
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 15,160
  5. Avatar for incognito group 15. incognito group 1 pt. 15,160
  1. Avatar for Steven Pletsch 21. Steven Pletsch Lv 1 11 pts. 40,591
  2. Avatar for TheGUmmer 22. TheGUmmer Lv 1 10 pts. 40,578
  3. Avatar for maithra 23. maithra Lv 1 9 pts. 40,554
  4. Avatar for alcor29 24. alcor29 Lv 1 8 pts. 40,497
  5. Avatar for Anfinsen_slept_here 25. Anfinsen_slept_here Lv 1 7 pts. 40,350
  6. Avatar for manu8170 26. manu8170 Lv 1 6 pts. 40,344
  7. Avatar for spvincent 27. spvincent Lv 1 5 pts. 40,309
  8. Avatar for Zhang Ruichong 28. Zhang Ruichong Lv 1 4 pts. 40,287
  9. Avatar for BarrySampson 29. BarrySampson Lv 1 4 pts. 40,242
  10. Avatar for vybi 30. vybi Lv 1 3 pts. 40,189

Comments