Placeholder image of a protein
Icon representing a puzzle

2475: Electron Density Reconstruction 95

Closed since almost 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
June 21, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's got two chains that are the same. For this first round of this puzzle, we won't have the Refine Density tool active. There's two identical chains here, but different parts may be not visible in each.

Sequence
MKHHHHHHPMSGLVPRGSMALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 41,361
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 70 pts. 41,255
  3. Avatar for Marvin's bunch 3. Marvin's bunch 47 pts. 41,033
  4. Avatar for Go Science 4. Go Science 30 pts. 41,021
  5. Avatar for Contenders 5. Contenders 19 pts. 40,945
  6. Avatar for Australia 6. Australia 11 pts. 40,776
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 7 pts. 40,642
  8. Avatar for Void Crushers 8. Void Crushers 4 pts. 40,578
  9. Avatar for Team China 9. Team China 2 pts. 40,287
  10. Avatar for VeFold 10. VeFold 1 pt. 40,242

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 41,332
  2. Avatar for christioanchauvin 2. christioanchauvin Lv 1 92 pts. 41,255
  3. Avatar for grogar7 3. grogar7 Lv 1 84 pts. 41,208
  4. Avatar for dcrwheeler 4. dcrwheeler Lv 1 76 pts. 41,191
  5. Avatar for Punzi Baker 3 5. Punzi Baker 3 Lv 1 70 pts. 41,124
  6. Avatar for blazegeek 6. blazegeek Lv 1 63 pts. 41,104
  7. Avatar for gmn 7. gmn Lv 1 57 pts. 41,102
  8. Avatar for fpc 8. fpc Lv 1 52 pts. 41,033
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 47 pts. 41,021
  10. Avatar for NinjaGreg 10. NinjaGreg Lv 1 42 pts. 41,014

Comments