Placeholder image of a protein
Icon representing a puzzle

2475: Electron Density Reconstruction 95

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
June 21, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's got two chains that are the same. For this first round of this puzzle, we won't have the Refine Density tool active. There's two identical chains here, but different parts may be not visible in each.

Sequence
MKHHHHHHPMSGLVPRGSMALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 37,833
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 36,715
  3. Avatar for Window Group 13. Window Group 1 pt. 15,640
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 15,160
  5. Avatar for incognito group 15. incognito group 1 pt. 15,160
  1. Avatar for Larini 31. Larini Lv 1 3 pts. 40,145
  2. Avatar for Trajan464 32. Trajan464 Lv 1 2 pts. 40,140
  3. Avatar for Th1sN@me!sN0tAPun 33. Th1sN@me!sN0tAPun Lv 1 2 pts. 40,053
  4. Avatar for ProfVince 34. ProfVince Lv 1 2 pts. 40,009
  5. Avatar for zbp 35. zbp Lv 1 1 pt. 39,930
  6. Avatar for rosie4loop 36. rosie4loop Lv 1 1 pt. 39,711
  7. Avatar for hada 37. hada Lv 1 1 pt. 39,680
  8. Avatar for Dr.Sillem 38. Dr.Sillem Lv 1 1 pt. 39,370
  9. Avatar for Merf 39. Merf Lv 1 1 pt. 38,749
  10. Avatar for Mohoernchen 40. Mohoernchen Lv 1 1 pt. 38,539

Comments