Placeholder image of a protein
Icon representing a puzzle

2475: Electron Density Reconstruction 95

Closed since almost 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
June 21, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's got two chains that are the same. For this first round of this puzzle, we won't have the Refine Density tool active. There's two identical chains here, but different parts may be not visible in each.

Sequence
MKHHHHHHPMSGLVPRGSMALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 41,361
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 70 pts. 41,255
  3. Avatar for Marvin's bunch 3. Marvin's bunch 47 pts. 41,033
  4. Avatar for Go Science 4. Go Science 30 pts. 41,021
  5. Avatar for Contenders 5. Contenders 19 pts. 40,945
  6. Avatar for Australia 6. Australia 11 pts. 40,776
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 7 pts. 40,642
  8. Avatar for Void Crushers 8. Void Crushers 4 pts. 40,578
  9. Avatar for Team China 9. Team China 2 pts. 40,287
  10. Avatar for VeFold 10. VeFold 1 pt. 40,242

  1. Avatar for Galaxie 11. Galaxie Lv 1 38 pts. 41,010
  2. Avatar for Sandrix72 12. Sandrix72 Lv 1 34 pts. 40,989
  3. Avatar for Bletchley Park 13. Bletchley Park Lv 1 30 pts. 40,945
  4. Avatar for akaaka 14. akaaka Lv 1 27 pts. 40,930
  5. Avatar for AlkiP0Ps 15. AlkiP0Ps Lv 1 24 pts. 40,776
  6. Avatar for BootsMcGraw 16. BootsMcGraw Lv 1 22 pts. 40,740
  7. Avatar for drumpeter18yrs9yrs 17. drumpeter18yrs9yrs Lv 1 19 pts. 40,728
  8. Avatar for NPrincipi 18. NPrincipi Lv 1 17 pts. 40,661
  9. Avatar for WBarme1234 19. WBarme1234 Lv 1 15 pts. 40,642
  10. Avatar for orily1337 20. orily1337 Lv 1 13 pts. 40,637

Comments