Placeholder image of a protein
Icon representing a puzzle

2475: Electron Density Reconstruction 95

Closed since almost 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
June 21, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's got two chains that are the same. For this first round of this puzzle, we won't have the Refine Density tool active. There's two identical chains here, but different parts may be not visible in each.

Sequence
MKHHHHHHPMSGLVPRGSMALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 41,361
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 70 pts. 41,255
  3. Avatar for Marvin's bunch 3. Marvin's bunch 47 pts. 41,033
  4. Avatar for Go Science 4. Go Science 30 pts. 41,021
  5. Avatar for Contenders 5. Contenders 19 pts. 40,945
  6. Avatar for Australia 6. Australia 11 pts. 40,776
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 7 pts. 40,642
  8. Avatar for Void Crushers 8. Void Crushers 4 pts. 40,578
  9. Avatar for Team China 9. Team China 2 pts. 40,287
  10. Avatar for VeFold 10. VeFold 1 pt. 40,242

  1. Avatar for Steven Pletsch 21. Steven Pletsch Lv 1 11 pts. 40,591
  2. Avatar for TheGUmmer 22. TheGUmmer Lv 1 10 pts. 40,578
  3. Avatar for maithra 23. maithra Lv 1 9 pts. 40,554
  4. Avatar for alcor29 24. alcor29 Lv 1 8 pts. 40,497
  5. Avatar for Anfinsen_slept_here 25. Anfinsen_slept_here Lv 1 7 pts. 40,350
  6. Avatar for manu8170 26. manu8170 Lv 1 6 pts. 40,344
  7. Avatar for spvincent 27. spvincent Lv 1 5 pts. 40,309
  8. Avatar for Zhang Ruichong 28. Zhang Ruichong Lv 1 4 pts. 40,287
  9. Avatar for BarrySampson 29. BarrySampson Lv 1 4 pts. 40,242
  10. Avatar for vybi 30. vybi Lv 1 3 pts. 40,189

Comments