Placeholder image of a protein
Icon representing a puzzle

2475: Electron Density Reconstruction 95

Closed since almost 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
June 21, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's got two chains that are the same. For this first round of this puzzle, we won't have the Refine Density tool active. There's two identical chains here, but different parts may be not visible in each.

Sequence
MKHHHHHHPMSGLVPRGSMALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 41,361
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 70 pts. 41,255
  3. Avatar for Marvin's bunch 3. Marvin's bunch 47 pts. 41,033
  4. Avatar for Go Science 4. Go Science 30 pts. 41,021
  5. Avatar for Contenders 5. Contenders 19 pts. 40,945
  6. Avatar for Australia 6. Australia 11 pts. 40,776
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 7 pts. 40,642
  8. Avatar for Void Crushers 8. Void Crushers 4 pts. 40,578
  9. Avatar for Team China 9. Team China 2 pts. 40,287
  10. Avatar for VeFold 10. VeFold 1 pt. 40,242

  1. Avatar for Larini 31. Larini Lv 1 3 pts. 40,145
  2. Avatar for Trajan464 32. Trajan464 Lv 1 2 pts. 40,140
  3. Avatar for Th1sN@me!sN0tAPun 33. Th1sN@me!sN0tAPun Lv 1 2 pts. 40,053
  4. Avatar for ProfVince 34. ProfVince Lv 1 2 pts. 40,009
  5. Avatar for zbp 35. zbp Lv 1 1 pt. 39,930
  6. Avatar for rosie4loop 36. rosie4loop Lv 1 1 pt. 39,711
  7. Avatar for hada 37. hada Lv 1 1 pt. 39,680
  8. Avatar for Dr.Sillem 38. Dr.Sillem Lv 1 1 pt. 39,370
  9. Avatar for Merf 39. Merf Lv 1 1 pt. 38,749
  10. Avatar for Mohoernchen 40. Mohoernchen Lv 1 1 pt. 38,539

Comments