Placeholder image of a protein
Icon representing a puzzle

2475: Electron Density Reconstruction 95

Closed since almost 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
June 21, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It's got two chains that are the same. For this first round of this puzzle, we won't have the Refine Density tool active. There's two identical chains here, but different parts may be not visible in each.

Sequence
MKHHHHHHPMSGLVPRGSMALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 41,361
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 70 pts. 41,255
  3. Avatar for Marvin's bunch 3. Marvin's bunch 47 pts. 41,033
  4. Avatar for Go Science 4. Go Science 30 pts. 41,021
  5. Avatar for Contenders 5. Contenders 19 pts. 40,945
  6. Avatar for Australia 6. Australia 11 pts. 40,776
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 7 pts. 40,642
  8. Avatar for Void Crushers 8. Void Crushers 4 pts. 40,578
  9. Avatar for Team China 9. Team China 2 pts. 40,287
  10. Avatar for VeFold 10. VeFold 1 pt. 40,242

  1. Avatar for rinze 41. rinze Lv 1 1 pt. 38,267
  2. Avatar for abiogenesis 42. abiogenesis Lv 1 1 pt. 38,260
  3. Avatar for DScott 43. DScott Lv 1 1 pt. 38,233
  4. Avatar for carxo 44. carxo Lv 1 1 pt. 38,219
  5. Avatar for Kimdonghyeon 45. Kimdonghyeon Lv 1 1 pt. 37,994
  6. Avatar for osc 46. osc Lv 1 1 pt. 37,992
  7. Avatar for crannash 47. crannash Lv 1 1 pt. 37,928
  8. Avatar for furi0us 48. furi0us Lv 1 1 pt. 37,904
  9. Avatar for Swapper242 49. Swapper242 Lv 1 1 pt. 37,888
  10. Avatar for mart0258 50. mart0258 Lv 1 1 pt. 37,856

Comments