Placeholder image of a protein
Icon representing a puzzle

2480: Electron Density Reconstruction 97

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
June 25, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. For this first round of this puzzle, we won't have the Refine Density tool active. There are a few chunks of segments on this puzzle that are missing.

Sequence
MHHHHHHMKNVIFEDEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSQGGAAAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVRGEEVNGDATAGSIPG

Top groups

  1. Avatar for Foldit Staff 11. Foldit Staff 1 pt. 12,719
  1. Avatar for blazegeek 11. blazegeek Lv 1 33 pts. 22,303
  2. Avatar for AlkiP0Ps 12. AlkiP0Ps Lv 1 29 pts. 22,292
  3. Avatar for BootsMcGraw 13. BootsMcGraw Lv 1 26 pts. 22,283
  4. Avatar for Bletchley Park 14. Bletchley Park Lv 1 23 pts. 22,282
  5. Avatar for Steven Pletsch 15. Steven Pletsch Lv 1 20 pts. 22,280
  6. Avatar for alcor29 16. alcor29 Lv 1 17 pts. 22,268
  7. Avatar for SemperRabbit 17. SemperRabbit Lv 1 15 pts. 22,266
  8. Avatar for grogar7 18. grogar7 Lv 1 13 pts. 22,262
  9. Avatar for akaaka 19. akaaka Lv 1 11 pts. 22,247
  10. Avatar for manu8170 20. manu8170 Lv 1 10 pts. 22,242

Comments