Placeholder image of a protein
Icon representing a puzzle

2480: Electron Density Reconstruction 97

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
June 25, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. For this first round of this puzzle, we won't have the Refine Density tool active. There are a few chunks of segments on this puzzle that are missing.

Sequence
MHHHHHHMKNVIFEDEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSQGGAAAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVRGEEVNGDATAGSIPG

Top groups


  1. Avatar for Foldit Staff 11. Foldit Staff 1 pt. 12,719

  1. Avatar for drumpeter18yrs9yrs 21. drumpeter18yrs9yrs Lv 1 8 pts. 22,229
  2. Avatar for WBarme1234 22. WBarme1234 Lv 1 7 pts. 22,215
  3. Avatar for spvincent 23. spvincent Lv 1 6 pts. 22,190
  4. Avatar for rosie4loop 24. rosie4loop Lv 1 5 pts. 22,138
  5. Avatar for vybi 25. vybi Lv 1 4 pts. 22,135
  6. Avatar for Idiotboy 26. Idiotboy Lv 1 4 pts. 22,107
  7. Avatar for BarrySampson 27. BarrySampson Lv 1 3 pts. 22,056
  8. Avatar for Anfinsen_slept_here 28. Anfinsen_slept_here Lv 1 3 pts. 22,027
  9. Avatar for Th1sN@me!sN0tAPun 29. Th1sN@me!sN0tAPun Lv 1 2 pts. 21,986
  10. Avatar for Trajan464 30. Trajan464 Lv 1 2 pts. 21,902

Comments