Placeholder image of a protein
Icon representing a puzzle

2480: Electron Density Reconstruction 97

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
June 25, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. For this first round of this puzzle, we won't have the Refine Density tool active. There are a few chunks of segments on this puzzle that are missing.

Sequence
MHHHHHHMKNVIFEDEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSQGGAAAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVRGEEVNGDATAGSIPG

Top groups


  1. Avatar for Foldit Staff 11. Foldit Staff 1 pt. 12,719

  1. Avatar for hada 31. hada Lv 1 2 pts. 21,828
  2. Avatar for abiogenesis 32. abiogenesis Lv 1 1 pt. 21,821
  3. Avatar for Larini 33. Larini Lv 1 1 pt. 21,741
  4. Avatar for zbp 34. zbp Lv 1 1 pt. 21,732
  5. Avatar for Gerom 35. Gerom Lv 1 1 pt. 21,681
  6. Avatar for TgamesPi 36. TgamesPi Lv 1 1 pt. 21,667
  7. Avatar for Dr.Sillem 37. Dr.Sillem Lv 1 1 pt. 21,625
  8. Avatar for pfirth 38. pfirth Lv 1 1 pt. 21,618
  9. Avatar for carxo 39. carxo Lv 1 1 pt. 21,575
  10. Avatar for Merf 40. Merf Lv 1 1 pt. 21,489

Comments