2481: Electron Density Reconstruction 96

Closed since over 1 year ago

Summary

• Created: June 28, 2024
• Expires: July 11, 2024 at 18:00 UTC
• Max points: 100

Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. You may notice that there’s a base pair in here that doesn’t look normal; it’s a Hoogsteen base pair (as opposed to Watson-Crick). Later on, we’ll ask you to play another version of this puzzle where it’s been put in as Watson-Crick instead of Hoogsteen as we’d like to see which works better. Also, a reminder that DNA sidechains can be turned relative to their blue arms with bands.

• Sequence: ACTGTTTACTCTTTAACGTAT ATACGTTAAAGAGTAAACAGT GPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRH

Top groups

• 1. Anthropic Dreams 100 pts. 53,640
• 2. L'Alliance Francophone 52 pts. 53,500
• 3. Contenders 24 pts. 53,340
• 4. Go Science 10 pts. 53,278
• 5. Marvin's bunch 4 pts. 53,241
• 6. Australia 1 pt. 53,118
• 7. Void Crushers 1 pt. 52,937
• 8. FamilyBarmettler 1 pt. 52,660
• 9. VeFold 1 pt. 51,176

Top evolvers

• 1. Galaxie 100 pts. 53,640
• 2. LociOiling 24 pts. 53,533
• 3. alcor29 4 pts. 53,486
• 4. Bruno Kestemont 1 pt. 53,121
• 5. Anfinsen_slept_here 1 pt. 53,083

Comments

[LociOiling]

This puzzle is out of sequence. The next puzzle was 2478, but this is puzzle 2481.

[LociOiling]

To add to the mystery, this week's small molecule puzzle is in fact 2478.

We'll see what happens next week.