Placeholder image of a protein
Icon representing a puzzle

2481: Electron Density Reconstruction 96

Closed since almost 2 years ago

Novice Novice Novice Novice Overall Overall Overall Overall Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density

Summary


Created
June 28, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. You may notice that there’s a base pair in here that doesn’t look normal; it’s a Hoogsteen base pair (as opposed to Watson-Crick). Later on, we’ll ask you to play another version of this puzzle where it’s been put in as Watson-Crick instead of Hoogsteen as we’d like to see which works better. Also, a reminder that DNA sidechains can be turned relative to their blue arms with bands.

Sequence
ACTGTTTACTCTTTAACGTAT ATACGTTAAAGAGTAAACAGT GPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 53,640
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 52 pts. 53,500
  3. Avatar for Contenders 3. Contenders 24 pts. 53,340
  4. Avatar for Go Science 4. Go Science 10 pts. 53,278
  5. Avatar for Marvin's bunch 5. Marvin's bunch 4 pts. 53,241
  6. Avatar for Australia 6. Australia 1 pt. 53,118
  7. Avatar for Void Crushers 7. Void Crushers 1 pt. 52,937
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 52,660
  9. Avatar for VeFold 9. VeFold 1 pt. 51,176

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 53,565
  2. Avatar for christioanchauvin 2. christioanchauvin Lv 1 92 pts. 53,500
  3. Avatar for Punzi Baker 3 3. Punzi Baker 3 Lv 1 84 pts. 53,349
  4. Avatar for Bletchley Park 4. Bletchley Park Lv 1 77 pts. 53,340
  5. Avatar for Galaxie 5. Galaxie Lv 1 70 pts. 53,310
  6. Avatar for NinjaGreg 6. NinjaGreg Lv 1 64 pts. 53,278
  7. Avatar for fpc 7. fpc Lv 1 58 pts. 53,241
  8. Avatar for NPrincipi 8. NPrincipi Lv 1 53 pts. 53,229
  9. Avatar for Sandrix72 9. Sandrix72 Lv 1 48 pts. 53,199
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 44 pts. 53,139

Comments


LociOiling Lv 1

To add to the mystery, this week's small molecule puzzle is in fact 2478.

We'll see what happens next week.