Icon representing a puzzle

2479: Revisiting Puzzle 63: Spinach Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary


Created
July 10, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups


  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 6,384

  1. Avatar for orily1337 11. orily1337 Lv 1 40 pts. 11,064
  2. Avatar for NinjaGreg 12. NinjaGreg Lv 1 36 pts. 11,061
  3. Avatar for akaaka 13. akaaka Lv 1 33 pts. 11,044
  4. Avatar for AlphaFold2 14. AlphaFold2 Lv 1 29 pts. 11,043
  5. Avatar for Galaxie 15. Galaxie Lv 1 26 pts. 11,041
  6. Avatar for grogar7 16. grogar7 Lv 1 24 pts. 11,014
  7. Avatar for drumpeter18yrs9yrs 17. drumpeter18yrs9yrs Lv 1 21 pts. 10,999
  8. Avatar for Bruno Kestemont 18. Bruno Kestemont Lv 1 19 pts. 10,980
  9. Avatar for AlkiP0Ps 19. AlkiP0Ps Lv 1 17 pts. 10,940
  10. Avatar for Anfinsen_slept_here 20. Anfinsen_slept_here Lv 1 15 pts. 10,915

Comments