Icon representing a puzzle

2479: Revisiting Puzzle 63: Spinach Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
July 10, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 6,384
  1. Avatar for rosie4loop 31. rosie4loop Lv 1 3 pts. 10,606
  2. Avatar for Th1sN@me!sN0tAPun 32. Th1sN@me!sN0tAPun Lv 1 3 pts. 10,578
  3. Avatar for Vinara 33. Vinara Lv 1 3 pts. 10,546
  4. Avatar for vybi 34. vybi Lv 1 2 pts. 10,539
  5. Avatar for Larini 35. Larini Lv 1 2 pts. 10,471
  6. Avatar for hada 36. hada Lv 1 2 pts. 10,395
  7. Avatar for Hellcat6 37. Hellcat6 Lv 1 1 pt. 10,301
  8. Avatar for Dr.Sillem 38. Dr.Sillem Lv 1 1 pt. 10,274
  9. Avatar for Arne Heessels 39. Arne Heessels Lv 1 1 pt. 10,207
  10. Avatar for Trajan464 40. Trajan464 Lv 1 1 pt. 10,179

Comments