Icon representing a puzzle

2483: Revisiting Puzzle 64: Thioredoxin

Closed since almost 2 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 12, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 10,937
  2. Avatar for Team China 12. Team China 1 pt. 10,911
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 10,788
  4. Avatar for Street Smarts 14. Street Smarts 1 pt. 10,230
  5. Avatar for Window Group 15. Window Group 1 pt. 7,870

  1. Avatar for christioanchauvin 11. christioanchauvin Lv 1 47 pts. 11,653
  2. Avatar for TheGUmmer 12. TheGUmmer Lv 1 44 pts. 11,642
  3. Avatar for ichwilldiesennamen 13. ichwilldiesennamen Lv 1 40 pts. 11,638
  4. Avatar for fpc 14. fpc Lv 1 37 pts. 11,632
  5. Avatar for dcrwheeler 15. dcrwheeler Lv 1 34 pts. 11,619
  6. Avatar for AlkiP0Ps 16. AlkiP0Ps Lv 1 31 pts. 11,615
  7. Avatar for g_b 17. g_b Lv 1 28 pts. 11,612
  8. Avatar for orily1337 18. orily1337 Lv 1 26 pts. 11,595
  9. Avatar for BootsMcGraw 19. BootsMcGraw Lv 1 24 pts. 11,589
  10. Avatar for akaaka 20. akaaka Lv 1 22 pts. 11,587

Comments