Icon representing a puzzle

2486: Revisiting Puzzle 66: Cytochrome

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
July 12, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,886
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 9,776
  3. Avatar for Team China 13. Team China 1 pt. 9,607
  4. Avatar for Gargleblasters 14. Gargleblasters 1 pt. 9,427
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,426
  6. Avatar for Window Group 16. Window Group 1 pt. 8,206
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 7,737
  1. Avatar for fpc 11. fpc Lv 1 49 pts. 10,221
  2. Avatar for Aubade01 12. Aubade01 Lv 1 46 pts. 10,219
  3. Avatar for blazegeek 13. blazegeek Lv 1 42 pts. 10,218
  4. Avatar for Punzi Baker 3 14. Punzi Baker 3 Lv 1 39 pts. 10,200
  5. Avatar for NPrincipi 15. NPrincipi Lv 1 36 pts. 10,196
  6. Avatar for alcor29 16. alcor29 Lv 1 33 pts. 10,196
  7. Avatar for ichwilldiesennamen 17. ichwilldiesennamen Lv 1 31 pts. 10,191
  8. Avatar for orily1337 18. orily1337 Lv 1 28 pts. 10,186
  9. Avatar for drumpeter18yrs9yrs 19. drumpeter18yrs9yrs Lv 1 26 pts. 10,185
  10. Avatar for g_b 20. g_b Lv 1 24 pts. 10,180

Comments