Icon representing a puzzle

2486: Revisiting Puzzle 66: Cytochrome

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
July 12, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,886
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 9,776
  3. Avatar for Team China 13. Team China 1 pt. 9,607
  4. Avatar for Gargleblasters 14. Gargleblasters 1 pt. 9,427
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,426
  6. Avatar for Window Group 16. Window Group 1 pt. 8,206
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 7,737
  1. Avatar for zanbato 31. zanbato Lv 1 8 pts. 10,080
  2. Avatar for mnucer 32. mnucer Lv 1 7 pts. 10,080
  3. Avatar for jawz101 33. jawz101 Lv 1 7 pts. 10,078
  4. Avatar for maithra 34. maithra Lv 1 6 pts. 10,077
  5. Avatar for Th1sN@me!sN0tAPun 35. Th1sN@me!sN0tAPun Lv 1 5 pts. 10,073
  6. Avatar for JuliaBCollet 36. JuliaBCollet Lv 1 5 pts. 10,053
  7. Avatar for zbp 37. zbp Lv 1 4 pts. 10,042
  8. Avatar for hada 38. hada Lv 1 4 pts. 10,039
  9. Avatar for Idiotboy 39. Idiotboy Lv 1 3 pts. 10,021
  10. Avatar for ppp6 40. ppp6 Lv 1 3 pts. 10,005

Comments