Icon representing a puzzle

2486: Revisiting Puzzle 66: Cytochrome

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
July 12, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,886
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 9,776
  3. Avatar for Team China 13. Team China 1 pt. 9,607
  4. Avatar for Gargleblasters 14. Gargleblasters 1 pt. 9,427
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,426
  6. Avatar for Window Group 16. Window Group 1 pt. 8,206
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 7,737
  1. Avatar for Pinteger 61. Pinteger Lv 1 1 pt. 9,538
  2. Avatar for Bletchley Park 62. Bletchley Park Lv 1 1 pt. 9,465
  3. Avatar for furi0us 63. furi0us Lv 1 1 pt. 9,449
  4. Avatar for mwm64 64. mwm64 Lv 1 1 pt. 9,427
  5. Avatar for Sammy3c2b1a0 65. Sammy3c2b1a0 Lv 1 1 pt. 9,426
  6. Avatar for Swapper242 66. Swapper242 Lv 1 1 pt. 9,392
  7. Avatar for Theo Chopard-Vilhem 67. Theo Chopard-Vilhem Lv 1 1 pt. 9,255
  8. Avatar for sp998 68. sp998 Lv 1 1 pt. 9,250
  9. Avatar for osc 69. osc Lv 1 1 pt. 9,211
  10. Avatar for TotoHuna68 70. TotoHuna68 Lv 1 1 pt. 9,050

Comments