Icon representing a puzzle

2486: Revisiting Puzzle 66: Cytochrome

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
July 12, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,289
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 10,259
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 10,233
  4. Avatar for Contenders 4. Contenders 36 pts. 10,224
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 10,221
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 10,169
  7. Avatar for Australia 7. Australia 10 pts. 10,168
  8. Avatar for VeFold 8. VeFold 6 pts. 10,134
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 4 pts. 10,098
  10. Avatar for Extraterrestrials 2.0 10. Extraterrestrials 2.0 2 pts. 10,080
  1. Avatar for TheGUmmer 21. TheGUmmer Lv 1 22 pts. 10,169
  2. Avatar for AlkiP0Ps 22. AlkiP0Ps Lv 1 20 pts. 10,168
  3. Avatar for gmn 23. gmn Lv 1 18 pts. 10,163
  4. Avatar for Anfinsen_slept_here 24. Anfinsen_slept_here Lv 1 17 pts. 10,149
  5. Avatar for akaaka 25. akaaka Lv 1 15 pts. 10,147
  6. Avatar for jausmh 26. jausmh Lv 1 14 pts. 10,139
  7. Avatar for Dr.Sillem 27. Dr.Sillem Lv 1 12 pts. 10,134
  8. Avatar for BarrySampson 28. BarrySampson Lv 1 11 pts. 10,123
  9. Avatar for Alistair69 29. Alistair69 Lv 1 10 pts. 10,112
  10. Avatar for WBarme1234 30. WBarme1234 Lv 1 9 pts. 10,098

Comments