Icon representing a puzzle

2486: Revisiting Puzzle 66: Cytochrome

Closed since almost 2 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 12, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for Go Science 100 pts. 10,289
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 10,259
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 10,233
  4. Avatar for Contenders 4. Contenders 36 pts. 10,224
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 10,221
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 10,169
  7. Avatar for Australia 7. Australia 10 pts. 10,168
  8. Avatar for VeFold 8. VeFold 6 pts. 10,134
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 4 pts. 10,098
  10. Avatar for Extraterrestrials 2.0 10. Extraterrestrials 2.0 2 pts. 10,080

  1. Avatar for ucad 41. ucad Lv 1 3 pts. 10,002
  2. Avatar for rosie4loop 42. rosie4loop Lv 1 2 pts. 9,989
  3. Avatar for heather-1 43. heather-1 Lv 1 2 pts. 9,932
  4. Avatar for nicobul 44. nicobul Lv 1 2 pts. 9,921
  5. Avatar for Larini 45. Larini Lv 1 2 pts. 9,889
  6. Avatar for pfirth 46. pfirth Lv 1 2 pts. 9,888
  7. Avatar for ShadowTactics 47. ShadowTactics Lv 1 1 pt. 9,886
  8. Avatar for Tian00 48. Tian00 Lv 1 1 pt. 9,874
  9. Avatar for nancy_annys 49. nancy_annys Lv 1 1 pt. 9,817
  10. Avatar for Trajan464 50. Trajan464 Lv 1 1 pt. 9,805

Comments