Icon representing a puzzle

2489: Revisiting Puzzle 67: Integrase

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
July 12, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 10,189
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 9,653
  3. Avatar for Androids 13. Androids 1 pt. 9,481
  4. Avatar for Mojo Risin' 14. Mojo Risin' 1 pt. 9,354
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 9,272
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 3,038
  1. Avatar for Sandrix72
    1. Sandrix72 Lv 1
    100 pts. 10,567
  2. Avatar for LociOiling 2. LociOiling Lv 1 94 pts. 10,514
  3. Avatar for Serca 3. Serca Lv 1 88 pts. 10,479
  4. Avatar for Galaxie 4. Galaxie Lv 1 82 pts. 10,476
  5. Avatar for grogar7 5. grogar7 Lv 1 77 pts. 10,471
  6. Avatar for Punzi Baker 3 6. Punzi Baker 3 Lv 1 71 pts. 10,437
  7. Avatar for NinjaGreg 7. NinjaGreg Lv 1 66 pts. 10,434
  8. Avatar for dcrwheeler 8. dcrwheeler Lv 1 62 pts. 10,431
  9. Avatar for christioanchauvin 9. christioanchauvin Lv 1 57 pts. 10,428
  10. Avatar for ichwilldiesennamen 10. ichwilldiesennamen Lv 1 53 pts. 10,422

Comments