Icon representing a puzzle

2489: Revisiting Puzzle 67: Integrase

Closed since almost 2 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 12, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups


  1. Avatar for Go Science 100 pts. 10,567
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,514
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 10,428
  4. Avatar for Contenders 4. Contenders 33 pts. 10,417
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,391
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 14 pts. 10,379
  7. Avatar for Team China 7. Team China 8 pts. 10,288
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 10,283
  9. Avatar for Australia 9. Australia 3 pts. 10,241
  10. Avatar for Extraterrestrials 2.0 10. Extraterrestrials 2.0 2 pts. 10,233

  1. Avatar for Sandrix72
    1. Sandrix72 Lv 1
    100 pts. 10,567
  2. Avatar for LociOiling 2. LociOiling Lv 1 94 pts. 10,514
  3. Avatar for Serca 3. Serca Lv 1 88 pts. 10,479
  4. Avatar for Galaxie 4. Galaxie Lv 1 82 pts. 10,476
  5. Avatar for grogar7 5. grogar7 Lv 1 77 pts. 10,471
  6. Avatar for Punzi Baker 3 6. Punzi Baker 3 Lv 1 71 pts. 10,437
  7. Avatar for NinjaGreg 7. NinjaGreg Lv 1 66 pts. 10,434
  8. Avatar for dcrwheeler 8. dcrwheeler Lv 1 62 pts. 10,431
  9. Avatar for christioanchauvin 9. christioanchauvin Lv 1 57 pts. 10,428
  10. Avatar for ichwilldiesennamen 10. ichwilldiesennamen Lv 1 53 pts. 10,422

Comments