Placeholder image of a protein
Icon representing a puzzle

2484: Electron Density Reconstruction 98

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
July 17, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. For this first round of this puzzle, we won't have the Refine Density tool active. There are a few chunks of segments on this puzzle that are missing.

Sequence
GPMPGKKFVARVEEILHDPGRTAPVARVKFEDGTKRVVIIPKGIKVGDVVEVKKV

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 13,003
  2. Avatar for Team China 12. Team China 1 pt. 12,827
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 12,645
  4. Avatar for Street Smarts 14. Street Smarts 1 pt. 9,839
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 13,202
  2. Avatar for NinjaGreg 2. NinjaGreg Lv 1 93 pts. 13,201
  3. Avatar for LociOiling 3. LociOiling Lv 1 87 pts. 13,199
  4. Avatar for christioanchauvin 4. christioanchauvin Lv 1 80 pts. 13,199
  5. Avatar for Sandrix72 5. Sandrix72 Lv 1 74 pts. 13,196
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 69 pts. 13,192
  7. Avatar for grogar7 7. grogar7 Lv 1 64 pts. 13,192
  8. Avatar for TheGUmmer 8. TheGUmmer Lv 1 59 pts. 13,188
  9. Avatar for Punzi Baker 3 9. Punzi Baker 3 Lv 1 54 pts. 13,186
  10. Avatar for dcrwheeler 10. dcrwheeler Lv 1 50 pts. 13,186

Comments