2484: Electron Density Reconstruction 98
Closed since over 1 year ago
Novice Overall Prediction Electron DensitySummary
- Created
- July 17, 2024
- Expires
- Max points
- 100
The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. For this first round of this puzzle, we won't have the Refine Density tool active. There are a few chunks of segments on this puzzle that are missing.
- Sequence
- GPMPGKKFVARVEEILHDPGRTAPVARVKFEDGTKRVVIIPKGIKVGDVVEVKKV