Placeholder image of a protein
Icon representing a puzzle

2487: Electron Density Reconstruction 99

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
July 24, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. Previously, we had a puzzle in which there was a Hoogsteen base pair in this structure, but now it has a Watson-Crick base pair instead. Also, a useful note for working with DNA: DNA sidechains can be turned relative to their blue arms with bands.

Sequence
ACTGTTTACTCTTTAACGTAT ATACGTTAAAGAGTAAACAGT GPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRH

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 51,874
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 51,838
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 50,235
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 20,179
  1. Avatar for NinjaGreg 11. NinjaGreg Lv 1 43 pts. 53,288
  2. Avatar for ichwilldiesennamen 12. ichwilldiesennamen Lv 1 39 pts. 53,249
  3. Avatar for dcrwheeler 13. dcrwheeler Lv 1 36 pts. 53,214
  4. Avatar for blazegeek 14. blazegeek Lv 1 33 pts. 53,193
  5. Avatar for TheGUmmer 15. TheGUmmer Lv 1 30 pts. 53,189
  6. Avatar for WBarme1234 16. WBarme1234 Lv 1 27 pts. 53,134
  7. Avatar for Steven Pletsch 17. Steven Pletsch Lv 1 24 pts. 52,927
  8. Avatar for alcor29 18. alcor29 Lv 1 22 pts. 52,908
  9. Avatar for AlkiP0Ps 19. AlkiP0Ps Lv 1 20 pts. 52,805
  10. Avatar for drumpeter18yrs9yrs 20. drumpeter18yrs9yrs Lv 1 18 pts. 52,786

Comments