Placeholder image of a protein
Icon representing a puzzle

2487: Electron Density Reconstruction 99

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
July 24, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. Previously, we had a puzzle in which there was a Hoogsteen base pair in this structure, but now it has a Watson-Crick base pair instead. Also, a useful note for working with DNA: DNA sidechains can be turned relative to their blue arms with bands.

Sequence
ACTGTTTACTCTTTAACGTAT ATACGTTAAAGAGTAAACAGT GPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRH

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 51,874
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 51,838
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 50,235
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 20,179
  1. Avatar for Anfinsen_slept_here 21. Anfinsen_slept_here Lv 1 16 pts. 52,769
  2. Avatar for rosie4loop 22. rosie4loop Lv 1 14 pts. 52,566
  3. Avatar for spvincent 23. spvincent Lv 1 13 pts. 52,460
  4. Avatar for BarrySampson 24. BarrySampson Lv 1 11 pts. 52,459
  5. Avatar for jausmh 25. jausmh Lv 1 10 pts. 52,414
  6. Avatar for Dr.Sillem 26. Dr.Sillem Lv 1 9 pts. 52,350
  7. Avatar for Idiotboy 27. Idiotboy Lv 1 8 pts. 52,337
  8. Avatar for akaaka 28. akaaka Lv 1 7 pts. 52,313
  9. Avatar for Trajan464 29. Trajan464 Lv 1 6 pts. 52,254
  10. Avatar for Alistair69 30. Alistair69 Lv 1 5 pts. 52,212

Comments