Placeholder image of a protein
Icon representing a puzzle

2487: Electron Density Reconstruction 99

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
July 24, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. Previously, we had a puzzle in which there was a Hoogsteen base pair in this structure, but now it has a Watson-Crick base pair instead. Also, a useful note for working with DNA: DNA sidechains can be turned relative to their blue arms with bands.

Sequence
ACTGTTTACTCTTTAACGTAT ATACGTTAAAGAGTAAACAGT GPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRH

Top groups


  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 51,874
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 51,838
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 50,235
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 20,179

  1. Avatar for nicobul 31. nicobul Lv 1 5 pts. 52,156
  2. Avatar for zanbato 32. zanbato Lv 1 4 pts. 52,150
  3. Avatar for Larini 33. Larini Lv 1 4 pts. 52,078
  4. Avatar for mwm64 34. mwm64 Lv 1 3 pts. 51,874
  5. Avatar for ShadowTactics 35. ShadowTactics Lv 1 3 pts. 51,838
  6. Avatar for Th1sN@me!sN0tAPun 36. Th1sN@me!sN0tAPun Lv 1 2 pts. 51,693
  7. Avatar for ppp6 37. ppp6 Lv 1 2 pts. 51,630
  8. Avatar for hada 38. hada Lv 1 2 pts. 51,493
  9. Avatar for Bletchley Park 39. Bletchley Park Lv 1 2 pts. 51,479
  10. Avatar for zbp 40. zbp Lv 1 1 pt. 51,475

Comments