Placeholder image of a protein
Icon representing a puzzle

2487: Electron Density Reconstruction 99

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
July 24, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. Previously, we had a puzzle in which there was a Hoogsteen base pair in this structure, but now it has a Watson-Crick base pair instead. Also, a useful note for working with DNA: DNA sidechains can be turned relative to their blue arms with bands.

Sequence
ACTGTTTACTCTTTAACGTAT ATACGTTAAAGAGTAAACAGT GPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRH

Top groups


  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 51,874
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 51,838
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 50,235
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 20,179

  1. Avatar for Tian00 41. Tian00 Lv 1 1 pt. 51,454
  2. Avatar for maithra 42. maithra Lv 1 1 pt. 51,133
  3. Avatar for KRUK94 43. KRUK94 Lv 1 1 pt. 50,476
  4. Avatar for mnucer 44. mnucer Lv 1 1 pt. 50,406
  5. Avatar for Mohoernchen 45. Mohoernchen Lv 1 1 pt. 50,404
  6. Avatar for alyssa_d_V2.0 46. alyssa_d_V2.0 Lv 1 1 pt. 50,235
  7. Avatar for WuWTq 47. WuWTq Lv 1 1 pt. 50,175
  8. Avatar for DScott 48. DScott Lv 1 1 pt. 50,034
  9. Avatar for osc 49. osc Lv 1 1 pt. 49,853
  10. Avatar for Pinteger 50. Pinteger Lv 1 1 pt. 49,852

Comments