Icon representing a puzzle

2492: Revisiting Puzzle 68: Bos Taurus

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
August 07, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for Window Group 11. Window Group 1 pt. 5,522
  1. Avatar for akaaka 11. akaaka Lv 1 44 pts. 10,693
  2. Avatar for Bletchley Park 12. Bletchley Park Lv 1 41 pts. 10,676
  3. Avatar for BootsMcGraw 13. BootsMcGraw Lv 1 37 pts. 10,652
  4. Avatar for blazegeek 14. blazegeek Lv 1 34 pts. 10,633
  5. Avatar for gmn 15. gmn Lv 1 31 pts. 10,608
  6. Avatar for orily1337 16. orily1337 Lv 1 28 pts. 10,598
  7. Avatar for Aubade01 17. Aubade01 Lv 1 25 pts. 10,548
  8. Avatar for AlkiP0Ps 18. AlkiP0Ps Lv 1 23 pts. 10,517
  9. Avatar for drumpeter18yrs9yrs 19. drumpeter18yrs9yrs Lv 1 21 pts. 10,512
  10. Avatar for christioanchauvin 20. christioanchauvin Lv 1 19 pts. 10,459

Comments