Icon representing a puzzle

2492: Revisiting Puzzle 68: Bos Taurus

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
August 07, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for Window Group 11. Window Group 1 pt. 5,522
  1. Avatar for WBarme1234 21. WBarme1234 Lv 1 17 pts. 10,453
  2. Avatar for fpc 22. fpc Lv 1 15 pts. 10,453
  3. Avatar for hookedwarm 23. hookedwarm Lv 1 14 pts. 10,440
  4. Avatar for alcor29 24. alcor29 Lv 1 12 pts. 10,352
  5. Avatar for hada 25. hada Lv 1 11 pts. 10,331
  6. Avatar for Th1sN@me!sN0tAPun 26. Th1sN@me!sN0tAPun Lv 1 10 pts. 10,294
  7. Avatar for Anfinsen_slept_here 27. Anfinsen_slept_here Lv 1 9 pts. 10,276
  8. Avatar for rosie4loop 28. rosie4loop Lv 1 8 pts. 10,265
  9. Avatar for BarrySampson 29. BarrySampson Lv 1 7 pts. 10,263
  10. Avatar for heather-1 30. heather-1 Lv 1 6 pts. 10,247

Comments