Icon representing a puzzle

2492: Revisiting Puzzle 68: Bos Taurus

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
August 07, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for Window Group 11. Window Group 1 pt. 5,522
  1. Avatar for DScott 51. DScott Lv 1 1 pt. 9,522
  2. Avatar for Trajan464 52. Trajan464 Lv 1 1 pt. 9,341
  3. Avatar for frostschutz 53. frostschutz Lv 1 1 pt. 9,282
  4. Avatar for rinze 54. rinze Lv 1 1 pt. 9,281
  5. Avatar for Nadohoi 55. Nadohoi Lv 1 1 pt. 9,085
  6. Avatar for d6ef 56. d6ef Lv 1 1 pt. 9,025
  7. Avatar for jawz101 57. jawz101 Lv 1 1 pt. 8,994
  8. Avatar for npetrillo81 58. npetrillo81 Lv 1 1 pt. 8,985
  9. Avatar for Sammy3c2b1a0 59. Sammy3c2b1a0 Lv 1 1 pt. 8,966
  10. Avatar for furi0us 60. furi0us Lv 1 1 pt. 8,959

Comments